Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5orgA_

Fold library idPDB HeaderMoleculeTitle
c5orgA_1.99PDB header: octopine-binding proteinChain: A: PDB Molecule: octopine-binding periplasmic protein;


Added to library: Sat Dec 23 08:52:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQEKSITIATEGGYAPWNFSGPGGKLDGFEIDLANALCEKMKAKCQIVAQNWDGIMPSLTGKKYDAIMAA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



S
BTTTB
TT

STT

STTTTSSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MSVTPKRQEVIGFSIPYAAGINGFAVMGDSKLAEMPGLGETYSLDSQADAAKKAIADISSFLNGTTVGVQ
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
B

TT

S



TTSGGGG
TTTT
TTTSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GSTTASTFLDKYFKGSVDIKEYKSVEEHNLDLTSGRLDAVLANATVLAAAIEKPEMKGAKLVGPLFSGGE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSSTBTTBSSTTS
STSGGGTTSTT
 .........220.........230.........240.........250.......
Sequence FGVVAVGLRKEDTALKADFDAAIKAASEDGTIKTLSLKWFKVDVTPQ
Predicted secondary structure















SS confidence














































Known secondary structure (DSSP) S



TT
TTSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D