Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oqtA_

Fold library idPDB HeaderMoleculeTitle
c5oqtA_2.86PDB header: transport proteinChain: A: PDB Molecule: amino acid transporter;


Added to library: Sat Feb 17 08:55:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LFRKKPIQLLMKESGAKGASLRKELGAFDLTMLGIGAIIGTGIFVLTGVAAAEHAGPALVLSFILSGLAC
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)





TSSS


B
SSTTTGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence VFAALCYAEFASTVPVSGSAYTYSYATFGELIAWILGWDLILEYGVASSAVAVGWSGYFQGLLSGELPKA
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S
SS

T






G
 .........150.........160.........170.........180.........190.........200.........210
Sequence LTSAYDPAKGTFIDLPAIIIVLFITFLLNLGAKKSARFNAVIVAIKVAVVLLFLAVGVWYVKPENWTPFM
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) GGSS


SSS



T



GGG

GGGTSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence PYGFSGVATGAATVFFAYIGFDAVSTAAEEVRNPQRDMPIGIIVSLLVCTLLYIAVSLVLTGIVPYEQLN
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTTTGGGTTGGGGGGGGGGBSSS
GGG

 .........290.........300.........310.........320.........330.........340.........350
Sequence VKNPVAFALNYIHQDWVAGFISLGAIAGITTVLLVMMYGQTRLFYAISRDGLLPKVFARISPTRQVPYVN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SSSTT
TTSS

TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence TWLTGAAVAVFAGIIPLNKLAELTNIGTLFAFITVSIGVLVLRKTQPDLKRAFRVPFVPVVPILAVLFCG
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) S
SSTTS

SS

SSTT
 .........430.........440.........450.......
Sequence YLVLQLPAMTWIGFVSWLLIGLVIYFIYGRKHSELNA
Predicted secondary structure






SS confidence




































Known secondary structure (DSSP) TTS
TTTTTSSTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D