Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5opjA_

Fold library idPDB HeaderMoleculeTitle
c5opjA_2.05PDB header: oxidoreductaseChain: A: PDB Molecule: rhamnogalacturonan lyase;


Added to library: Sat Mar 3 08:34:21 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HQVSYFSLQDVKLLSSPFLQAQQTDLHYILALDPDRLSAPFLREAGLTPKAPSYTNWENTGLDGHIGGHY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


B


GGG
SSS
TT


SS


SGGGTTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSALSXXYAATGDTAIYHRLNYXLNELHRAQQAVGTGFIGGTPGSLQLWKEIKAGDIRAGGFSLNGKWVP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


SS



STTTT


B
SSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LYNIHKTYAGLRDAYLYAHSDLARQXLIDLTDWXIDITSGLSDNQXQDXLRSEHGGLNETFADVAEITGD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TT

TTS

TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KKYLKLARRFSHKVILDPLIKNEDRLNGXHANTQIPKVIGYKRVAEVSKNDKDWNHAAEWDHAARFFWNT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS
TT



TT
BTTT
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence VVNHRSVCIGGNSVREHFHPSDNFTSXLNDVQGPETCNTYNXLRLTKXLYQNSGDVDNSNKPDPRYVDYY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) B
TTS
B
BTTB


TT


S


BTTSSSS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence ERALYNHILSSQEPDKGGFVYFTPXRPGHYRVYSQPETSXWCCVGSGLENHTKYGEFIYAHQQDTLYVNL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTGGGB
TTT

BBSB


STTB


B

TTT


TT
GGGGSTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence FIPSQLNWKEQGVTLTQETLFPDDEKVTLRIDKAAKKNLTLXIRIPEWAYEITINGKKHLSDIQTGASTY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


GGGT
TTSSS




TT

TT


S
SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence LPIRRKWKKGDXITFHLPXKVSLEQIPDKKDYYAFLYGPIVLATSTGTENLDGIYADDSRGGHIAHGRQT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TT





TT

STT
S

TTSB

SSTTTTS

S


 .........570.........580.........590.........600.........610.........620.........630
Sequence PLQEIPXLIGNPDSIRHSLHKLSGSKLAFSYDGNVYPTQSLELIPFFRLHNSRYAVYFRQASEEQFKTIQ
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
GGGS
S
T
SSSS


S
S


GGG

SSS
TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence EEXATAERKATELANRTVDLIFPGEQQPESDHSIQYEASETGTHKDRHFRRAKGWFSYNLKIKEEASQLX
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT
TT
TT
TTSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence ITVRQEDRNKAVILLNNEKLTVHPTVSKADKDGFIRLCYLLPRKLKVGSCEILFKPDGTEWTSAVYEVRL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT



TT

S





TTS
SSSSSS


B
 ..
Sequence LK
Predicted secondary structure
SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D