Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5olkD_

Fold library idPDB HeaderMoleculeTitle
c5olkD_2.45PDB header: oxidoreductaseChain: D: PDB Molecule: ribonucleoside-diphosphate reductase, beta subunit 1;


Added to library: Sat Jan 13 08:20:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKKIIKRDYSTAPFVLEKITNAIANAMAALGHGSEQDAKLISMQVYESLLNNKEQESEYIPTVEQVQDMV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTS


T











B
 .........80.........90.........100.........110.........120.........130.........140
Sequence EDKLMSSEFHDVAKAYIIYRNKRALERKTNIFEKRINLKPYEYPELNEYVAAIRHSYWIHTEFNFTSDIQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
T


TTS

S
SSS
S
GGGG


GGGS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DFKTGLSEVERSAIKNTMLAISQIEVAVKTFWGDVHHRLPKPEIAAVGATFAESEVRHHDAYSHLLEILG
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TTS
SS


GGGTS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LNEEFKELKKKPVIMKRVHYLETSLKHAKSDDDREYTESILLFALFIEHVSLFSQFLIIMAFNKHKNMLK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TGGG
TTTTT
S
TTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence GISNAVEATSKEEQIHGDFGVDIINIIKKENPEWFDEEHNNLIKEMCLNSFEAESKVVDWIFEKGELDFL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
GGGS
TTT


SSS
 .........360.........370.........380.........390...
Sequence PKAVINEFLKNRFNKSLEAIGLEKLFDIDEALLQETEWFDDEI
Predicted secondary structure






















SS confidence










































Known secondary structure (DSSP)
TT



S


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D