Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5olkD_

Fold library idPDB HeaderMoleculeTitle
c5olkD_2.45PDB header: oxidoreductaseChain: D: PDB Molecule: ribonucleoside-diphosphate reductase, beta subunit 1;


Added to library: Sat Jan 13 08:20:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKKIIKRDYSTAPFVLEKITNAIANAMAALGHGSEQDAKLISMQVYESLLNNKEQESEYIPTVEQVQDMV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTS


T











B
 .........80.........90.........100.........110.........120.........130.........140
Sequence EDKLMSSEFHDVAKAYIIYRNKRALERKTNIFEKRINLKPYEYPELNEYVAAIRHSYWIHTEFNFTSDIQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
T


TTS

S
SSS
S
GGGG


GGGS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DFKTGLSEVERSAIKNTMLAISQIEVAVKTFWGDVHHRLPKPEIAAVGATFAESEVRHHDAYSHLLEILG
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TTS
SS


GGGTS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LNEEFKELKKKPVIMKRVHYLETSLKHAKSDDDREYTESILLFALFIEHVSLFSQFLIIMAFNKHKNMLK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TGGG
TTTTT
S
TTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence GISNAVEATSKEEQIHGDFGVDIINIIKKENPEWFDEEHNNLIKEMCLNSFEAESKVVDWIFEKGELDFL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
GGGS
TTT


SSS
 .........360.........370.........380.........390...
Sequence PKAVINEFLKNRFNKSLEAIGLEKLFDIDEALLQETEWFDDEI
Predicted secondary structure






















SS confidence










































Known secondary structure (DSSP)
TT



S


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D