Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ol0B_

Fold library idPDB HeaderMoleculeTitle
c5ol0B_1.99PDB header: hydrolaseChain: B: PDB Molecule: putative silent information regulator 2,putative silent


Added to library: Sat Mar 3 08:36:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence APHQEHVLGEPTLEGLAHYIREKNVRRILVLVGAGASVAAGIPDFTDAFSLTLLREKPEIFYSIARELNL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
GGG
BTTBS
STT



GGGGGGGT




GGGB


 .........80.........90.........100.........110.........120.........130.........140
Sequence WPGHFQPTAVHHFIRLLQDEGRLLRCCTQNIDGLEKAAGVSPELLVEAHGSFAAAACIECHTPFSIEQNY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) STTSS


TT



S
TT

TTTTTTTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence LEAMSGTVSRCSTCGGIVKPNVVFFGENLPDAFFDALHHDAPIAELVIIIGTSMQVHPFALLPCVVPKSV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT


B
TTT

B

BTS


TTGGG
SS

S
STTGGGGGGGS
TTS
 .........220.........230.........240.........250.........260...
Sequence PRVVMNRERVGGLLFRFVCRDVLFRGDCQENVVTLAEYLGLSEALAKRMRLSD
Predicted secondary structure






















SS confidence




















































Known secondary structure (DSSP)

SS

SGGG



B

S
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D