Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5okiA_

Fold library idPDB HeaderMoleculeTitle
c5okiA_4.50PDB header: replicationChain: A: PDB Molecule: dna polymerase epsilon catalytic subunit a;


Added to library: Sat Dec 23 08:31:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ALSAQQLLNASKIDDIDSMMGFERYVPPQYNFDAKDIDQIPGVGWLTNMHATLVSQEERVTTNQGISGVD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TT

B








GGGTTSS









SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence FYFLDEEGGSFKSTVVYDPYFFIACNDESRVNDVEELVKKYLESCLKSLQILIKLSFVNSNQLFEARKLL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTS



S
GGGTTTT

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RPILQDNANNNVQVDAKHLIEDIREYDVPYHVRVSIDKDIRVGKWYKVTQQGFIEDTRKIAFADPVVMAF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)





GGGGS
S

TT

TTSTT
TT

S




 .........220.........230.........240.........250.........260.........270.........280
Sequence AIATTKPPLKFPDSAVDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKPEYPGFFTIFNENDEVALL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


TTS


TTT

TTTTTS
S





SSTTS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QRFFEHIRDVRPTVISTFNGDFFDWPFIHNRSKIHGLDMFDEIGFAPDAEGEYKSSYCSHMDCFRWVKRD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

SSSTTTTTT

S

TTS

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence SYLPQGSQGLKAVTQSKLGYNPIELDPELMTPYAFEKPQHLSEYSVSDAVATYYLYMKYVHPFIFSLCTI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S


GGG
ST
S





GGG
TTT
 .........430.........440.....
Sequence IPLNPDETLRKGTGTLCEMLLMVQA
Predicted secondary structure









SS confidence
























Known secondary structure (DSSP) SSS
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D