Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5okiA_

Fold library idPDB HeaderMoleculeTitle
c5okiA_4.50PDB header: replicationChain: A: PDB Molecule: dna polymerase epsilon catalytic subunit a;


Added to library: Sat Dec 23 08:31:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ALSAQQLLNASKIDDIDSMMGFERYVPPQYNFDAKDIDQIPGVGWLTNMHATLVSQEERVTTNQGISGVD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TT

B








GGGTTSS









SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence FYFLDEEGGSFKSTVVYDPYFFIACNDESRVNDVEELVKKYLESCLKSLQILIKLSFVNSNQLFEARKLL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTS



S
GGGTTTT

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RPILQDNANNNVQVDAKHLIEDIREYDVPYHVRVSIDKDIRVGKWYKVTQQGFIEDTRKIAFADPVVMAF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)





GGGGS
S

TT

TTSTT
TT

S




 .........220.........230.........240.........250.........260.........270.........280
Sequence AIATTKPPLKFPDSAVDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKPEYPGFFTIFNENDEVALL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


TTS


TTT

TTTTTS
S





SSTTS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QRFFEHIRDVRPTVISTFNGDFFDWPFIHNRSKIHGLDMFDEIGFAPDAEGEYKSSYCSHMDCFRWVKRD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

SSSTTTTTT

S

TTS

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence SYLPQGSQGLKAVTQSKLGYNPIELDPELMTPYAFEKPQHLSEYSVSDAVATYYLYMKYVHPFIFSLCTI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S


GGG
ST
S





GGG
TTT
 .........430.........440.....
Sequence IPLNPDETLRKGTGTLCEMLLMVQA
Predicted secondary structure









SS confidence
























Known secondary structure (DSSP) SSS
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D