Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ohxB_

Fold library idPDB HeaderMoleculeTitle
c5ohxB_3.20PDB header: lyaseChain: B: PDB Molecule: cystathionine beta-synthase;


Added to library: Sat Jan 6 08:31:35 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QPNRPSYCTWELNATNSPHTCRTKNGDYTKIMPDILTAIGQTPLIKLNNIPKSYGIKCEIYAKCEFLNPG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TTS






TT



SS




S

TTS

SSGGGGS





TT

S
TTSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSVKDRIAYRMIQDAEDKGLLKPGCTIIEPTSGNTGIGLAMAAAVRGYKCIIVMPEKMSDEKISTLYALG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SBTT


TT


SST


TTSS
STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKIIRTPTEASWHSPEAHISVAQKLQKEIPNSIILDQYTNPGNPLAHYDQTAIEIWKQCEGKIDYLVAGA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



SSS
TTSTTSSTT

TTT
TTTTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence GTGGTISGIGRKLKELSPNIKIIAVDPKGSILDPSSDEVGFYEVEGIGYDFIPTVLDRNVIDKWIKTEDN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SSS
TT
TT
S
SS







S

SS

SS

SS

TTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence ESLNAARMLIRQEGLLCGGSSGAALIAALKIAKDIPEEKRMVIILPDGIRNYLTKFVSEYWMETRGFLQP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)




TTS

TT

B
GGGGTTTTSSTTSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence VCQNEMNKWWWNMKISNLSFDKQSLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVISLNKLTSYV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



GGGGTTSS
BGGG







B
TTSSB
SSS

SSSSS


 .........430.........440.........450.........460.........470.........480........
Sequence ISGIVKCTDFVDKAMVKQYVKVKHSATLGYISRVLEKEPYVIILDDEHDDAFIGIVNQFHILQFITKN
Predicted secondary structure




























SS confidence



































































Known secondary structure (DSSP) TSS
TTSBGGGG
B



TTSBTTT
S
TTTTT
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D