Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ofbB_

Fold library idPDB HeaderMoleculeTitle
c5ofbB_2.02PDB header: nuclear proteinChain: B: PDB Molecule: morc family cw-type zinc finger protein 2;


Added to library: Sat Feb 17 08:25:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRIDIYAERREDLRGGFMLCFLDDG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SS

TTS





TTT
SSTT
S
TTSTTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGMDPSDAASVIQFGKLAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



TTSSS

TTS


TT
S

SS
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DEVIVPLPTWNARTREPVTDNVEKFAIETELIYKYSPFRTEEEVMTQFMKIPGDSGTLVIIFNLKLMDNG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
S





TTT


S
SS

STS
SSS
B
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EPELDIISNPRDIQMAETSPEGTKPERRSFRAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
BS
SSSTT

SS


TT

GGGTBSBSS

STT




GGGSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SSRFKTRAEQEVKKAEHVARIAEEKAREAESKARTLEVRLGLTRDSRVMLRQVQNRAITLRREADVKKRI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



 .........360.........370.........380.........390.........400.........410.........420
Sequence KEAKQRALKEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLVLE
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S


TT
TTS
TT

GGGGSSSSTTTT
TTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence PTHNKQDFADAKEYRHLLRAMGEHLAQYWKDIAIAQRGIIKFWDEFGYLSANWNQPPSSELRYKRRRAME
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B
TTSSSBS
T
TT

SSSTTS



STT
 .........500.........510.........520.........530.........540.
Sequence IPTTIQCDLCLKWRTLPFYPDTWVCSMNPDPEQDRCEASEQKQKVPLGTFR
Predicted secondary structure


































SS confidence


















































Known secondary structure (DSSP) S

TTT









GGG
S
TTS
STTS











Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D