Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5od2B_

Fold library idPDB HeaderMoleculeTitle
c5od2B_1.98PDB header: transferaseChain: B: PDB Molecule: bifunctional adp-specific glucokinase/phosphofructokinase;


Added to library: Sat Feb 3 08:17:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IMEIKKFIETIKGTKLFTAYNTNVDAIKYLKDEDVQKLVDEFNHKDIIERMEEYPRIIEEPLDFVARLVH
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TT
S



TS


SSBSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SIKTGKPAEVPIKDDKKLHEWFDRIKYDEERMGGQAGIVSNLMATLQIDKIIVYTPFLSKKQAEMFVDYD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T

B


TS

SSTT
S
S


TTS


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLLYPLVENGNLVLKKVREAYRDDPIKINRIFEFKKGLKFKLNGEEITAKQSTRFIVASRPEALRIEIKD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TTTGGG


S




TT
TT
SS



TT

SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence DVRKFLPKIGEAVDCAFLSGYQAIKEEYRDGKTAKYYFERAEEDIKLLKKNKNIKTHLEFASISNIEIRK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT
S

GGG

SB
TTS
BTSSS





S
 .........290.........300.........310.........320.........330.........340.........350
Sequence MVVDYILSNVESVGMDETEIANVLHILGYDELSNNILKDSFIEDVIEGAKILLDKFKNLEVVQVHTIYYI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TGGG
S
TT



TT


SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LFVCRADNPLSKEELEECLEFSTILASTKAKLGNIRAIDDLHEGLKIPHNKYGDLLKEIAEKFNDNNYKI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSSS
SS

SGGGS


TTTT

SS
 .........430.........440.........450........
Sequence ALSPSRYVEKPKSTVGLGDTISSGAFVYYVSLLNKKRM
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP)



SS
S

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D