Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ocmA_

Fold library idPDB HeaderMoleculeTitle
c5ocmA_1.81PDB header: oxidoreductaseChain: A: PDB Molecule: nad_gly3p_dh, nad-dependent glycerol-3-phosphate


Added to library: Sat May 19 08:35:43 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RDTDVTVLGLGLMGQALAGAFLKDGHATTVWNRSEGKAGQLAEQGAVLASSARDAAEASPLVVVCVSDHA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


S

STT


SSSSS
TT

SST
S

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AVRAVLDPLGDVLAGRVLVNLTSGTSEQARATAEWAAERGITYLDGAIMAIPQVVGTADAFLLYSGPEAA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGTTTTTTS




TT
S
TTTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence YEAHEPTLRSLGAGTTYLGADHGLSSLYDVALLGIMWGTLNSFLHGAALLGTAKVEATTFAPFANRWIEA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) GGGS
TTTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence VTGFVSAYAGQVDQGAYPALDATIDTHVATVDHLIHESEAAGVNTELPRLVRTLADRALAGGQGGLGYAA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T



SS
BT


TT
TTSBGGG
 .........290
Sequence MIEQFRSPSA
Predicted secondary structure



SS confidence









Known secondary structure (DSSP) GSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D