Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oayA_

Fold library idPDB HeaderMoleculeTitle
c5oayA_UNKPDB header: signaling proteinChain: A: PDB Molecule: transcriptional regulator whib1;


Added to library: Sat Jan 6 08:15:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TS
S


S
SSS


T


SSS



 ......
Sequence LKRRNA
Predicted secondary structure


SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D