Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oarB_

Fold library idPDB HeaderMoleculeTitle
c5oarB_2.30PDB header: hydrolaseChain: B: PDB Molecule: beta-hexosaminidase;


Added to library: Sat Dec 30 08:34:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNSLQYVNVQVKDIEADLQHGVDESYTLDVEEDSDTITINAETVWGALHAFTTLQQLVISDGHGGLIIEE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




S


S
TT




TT
STT
SSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVNIKDSPLYPYRGIMLDTGRNFVSLPKIFEQLEGMSLSKLNVLHWHIDDAQSWPIWVDVYPEMVKDAYS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


S
S
SSS


T



BTTB

B

TT
GGGGGGSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PHEIYSRNDVRNIVNYARARGIRVIPEIDMPSHSSSGWKQVDPEMVTCTDSWWSNDDWPLHTAVEPNPGQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTS
B
TT
SSS

TT
GGGSTTS


SSSGGG


SSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence LDIIYNKTYEVVGNVYKELSDIFPDHWFHVGGDEIQPNCFNFSTHVTKWFAEDPSRTYHDLAQYWVDHAV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SS
TT

SS




GGGGGG
TSTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence PIFQNYSQERRLVMWEDIALSADNAHDVPKNIVMQSWNNGLEYISNLTARGYDVIVSSSDFLYLDCGHGG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT
TT
TSTT

S


TTS
SSTTT



TTTS
TTTTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence FVTNDPRYNVMANPDANTPNFNYGGNGGSWCAPYKTWQRIYDYDFTLNLTETQAKHIIGATAPLWGEQVD
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

SS
GGG

SS
S
TTS
BTTBBS
TT
TT
S


T

TTTT

TTTGGG

TT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence DINVSSMFWPRAAALAELVWSGNRDANGNKRTTEMTQRILNFREYLVANGVQAQALVPKYCLQHPHACDL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT
SB
TTS
B
TT





S
STTTT
S
 .......
Sequence YRNQAAI
Predicted secondary structure






SS confidence






Known secondary structure (DSSP)
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D