Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oakA_

Fold library idPDB HeaderMoleculeTitle
c5oakA_1.50PDB header: protein bindingChain: A: PDB Molecule: bazooka, isoform c,ld29223p;


Added to library: Sat Feb 24 08:30:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AMGDGEMLLIINEYGSPLGLTALPDKEHGGGLLVQHVEPGSRAERGRLRRDDRILEINGIKLIGLTESQV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT



TTS

S
TTTTSS
TTSTT

TT
TT
TT

 .........80.........90
Sequence QEQLRRALESSELRVRVLRG
Predicted secondary structure





SS confidence



















Known secondary structure (DSSP) TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D