Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o98A_

Fold library idPDB HeaderMoleculeTitle
c5o98A_1.55PDB header: oxidoreductaseChain: A: PDB Molecule: alcohol dehydrogenase 1;


Added to library: Sat Feb 24 08:44:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEKYAVVTGSNKGIGFETCKKLASQGITVVLTARDEKRGLDALEKLKELGLSGKVLFHQLDVTDSSSVAS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SS
SSTT
SSTTT
SS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAEFVKKQFGRLDILVNNAGVNGVITDDPADVDFSKIYKETYELAEECIQINYFGTKRTTDALLPLLQLS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
S




S



TT


TTS

TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASPRIVNISSIMGQLKNIPSEWAKGILGDASNLTEDRLDEVINNFLKDFKEGSLAAKGWPPSFSAYIVSK
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) SS


GGGSGGG


T
GGG

T
TTTTT

SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VVVNAYTRILAKKYPNFKINCVCPGFAKTDLNHGLGLLTAEEAAENPVKLALLPDDGPSGLFFDRSEESS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTS

SB
SGGGTT

SB
T

TT


S
TT
 ..
Sequence FE
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D