Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o8rA_

Fold library idPDB HeaderMoleculeTitle
c5o8rA_2.80PDB header: biosynthetic proteinChain: A: PDB Molecule: l-lysine 6-monooxygenase involved in desferrioxamine


Added to library: Sat Mar 3 08:51:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NTIYDFIGIGIGPFNLGLACLSEPVEGLNGVFLDQNPGFDWHTGMMLESAHLQTPFMADLVTLADPTSPY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S

STTSTT


SSSS



TTT

TT
TTSSSSTTT
TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SLLNFMKQKGKLYSFYIREDFFLMRKEYNQYCQWAAERLGNLRWNTRVEYVSYDDNLQCYRVRSTDTVSG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) STT


S
SS
STTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence KQQEWLAHRLVLGTGPSAWSPACSQPYRERFVHSSEYLLNKEKLQKKRSITVLGSGQSAAEIYYDLLTDI
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
S







GGGGGGTTTSGGGTSS

STTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DRFGYQLNWITRAPRFYPLEYTKLTLEMTSPEWIDYFHSLPAAKRDELNASQKNLYKGINSSLINAIYDL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTS


SSSS

B



TTSS
S

SSSTTTGGGTSSB
 .........290.........300.........310.........320.........330.........340.........350
Sequence LYVKQLDGKLDVNLFTHSELTDMRWLAEGEFELKLHQQEQDRAYSRRTEGLVMATGYHYQPPAFVEGIQQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTS



STTTTTTTS






GGGGGGGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence RIQWDEKDRYDVQRNYSIDRHNQVFVQNAELHTHGFVTPDLGMACYRNSVLLREITGREVYPVERQIAFQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) GB
TTT


TTSB
BSSS
SS

TTTTGGGTT
GGGSS
SS



S

SS
 .......
Sequence TFPAQSE
Predicted secondary structure






SS confidence






Known secondary structure (DSSP)

S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D