Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o7yA_

Fold library idPDB HeaderMoleculeTitle
c5o7yA_1.97PDB header: oxidoreductaseChain: A: PDB Molecule: thebaine 6-o-demethylase;


Added to library: Sat Feb 17 08:28:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNAMEKAKLMKLGNGMEIPSVQELAKLTLAEIPSRYVCANLLPMGHETIPVIDIENLLSPEPIIGKLELD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)




TTSB


T

SS

GGGS





B





T
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLHFACKEWGFFQVVNHGVDASLVDSVKSEIQGFFNLSMDEKTKYEQEDGDVEGFGQGFIESEDQTLDWA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TSS



TS
T
S


TT





B


TT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence DIFMMFTLPLHLRKPHLFSKLPVPLRETIESYSSEMKKLSMVLFNKMEKALQVQAAEIKGMSEVFIDGTQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SGGGS
S
TT

TTTS

ST
 .........220.........230.........240.........250.........260.........270.........280
Sequence AMRMNYYPPCPQPNLAIGLTSHSDFGGLTILLQINEVEGLQIKREGTWISVKPLPNAFVVNVGDILEIMT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


SSTTT

S


SS
SS


TT



TT

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence NGIYHSVDHRAVVNSTNERLSIATFHDPSLESVIGPISSLITPETPALFKSGSTYGDLVEECKTRKLDGK
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTSS






SS



TT



GGG

SSS


B


S
SSS
 ........
Sequence SFLDSMRI
Predicted secondary structure



SS confidence







Known secondary structure (DSSP)
TB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D