Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o7oD_

Fold library idPDB HeaderMoleculeTitle
c5o7oD_2.11PDB header: biosynthetic proteinChain: D: PDB Molecule: desferrioxamine siderophore biosynthesis protein dfoc;


Added to library: Sat Mar 3 08:42:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AGTWLTGDNWAEANRLLIRKAIAEFAHEKIVTPAECAHGRYSLAVPGSETEYQFTASRLALDHWEIDAAS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TT

TTSS

SSSS
TTSSTTT
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTKQENGHPLALDALQFITEFNEVIGIPQALLATYMEEISSTLCSSVFKLQKNNPDSRALVNADFQTVES
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT



T


S



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SMTEGHPCFVANNGRIGFDARDYLAYAPEAATPVNLIWVAVHRRNAHFSSLSDLQYERLMREELGQSTVE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



SSS
SS



TT


TTT


B

TTT
TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence QFNAQLTEKGLTHADYLFMPVHPWQWQNKLLTVFAADIANNDIVWLGVGDDQYQAQQSIRTFFNRSHPNK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT

GGG
TTTTS
SS

TTSSSSSTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence RYVKTALSVLNMGFMRGLSPYYMATTPAINEWLQDLVAGDEWLQRCDFRILREVAAVGYHNRHYEKAIKG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S

SSS





T
TT





S
 .........360.........370.........380.........390.........400.........410.........420
Sequence DSAYKKMFAALWRDNPVAELKPGQRLMTMASFLHVDHHQKALLPALIADSGLAAERWVERYLSCYLSPLL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

GGGSSS

GGGG

TTGGGGG
B
TTS
B


T
 .........430.........440.........450.........460.........470.........480.........490
Sequence HCFYQHDLVFMPHGENLILLLENNVPVSAYMKDIGEEIAVMNPDAVLPEKVQRLAVDVPENLKLLSVFTD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



STTTTT


TTT

TT



GGGGGG


GGGTT

 .........500.........510.........520.........530.........540.........550.........560
Sequence VFDCIFRFISAILHQSATLPEEQFWQAVARCVKEYQQAHPHLASKFSRYDMFAPEFTRSCLNRLQLANEN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


TTTTSS
T
GGGS
TT
S
T


 .........570.....
Sequence LKFAGTLVNPIARWR
Predicted secondary structure














SS confidence














Known secondary structure (DSSP)


TTGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D