Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o6vC_

Fold library idPDB HeaderMoleculeTitle
c5o6vC_3.90PDB header: virusChain: C: PDB Molecule: genome polyprotein;


Added to library: Sat Feb 10 08:26:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAQTREYCLHAKLSDTKV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

GGGSS
B


TT

BT
BTTS


BS

B

BSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence AARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TTS




GGGSSTT



TTTT
S

S



TT
B
B
BB

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S



SSS

TT

TT



TTSSSSSS
GGG

B

SSSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TAWQVHRDWFNDLALPWKHEGARNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
B
T

S

TT

S
BT
SSS



SSS







TTTTTTS
SS

BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence YHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS


S
SSS
B

SS


SSS

SS
S


SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSYQWFQKGSSIGRVFQKTKKGIERLTVIGEHA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
B

SSSS

SS







S
TT




SSSSGGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence WDFGSAGGFLSSIGKALHTVLGGAFNSIFGGVGFLPKLLLGVALAWLGLNMRNPTMSMSFLLAGVLVLAM
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
TTSS

STTTSTTS

S
S
SSGGGTS
 ..
Sequence TL
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D