Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o6vC_

Fold library idPDB HeaderMoleculeTitle
c5o6vC_3.90PDB header: virusChain: C: PDB Molecule: genome polyprotein;


Added to library: Sat Feb 10 08:26:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAQTREYCLHAKLSDTKV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

GGGSS
B


TT

BT
BTTS


BS

B

BSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence AARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TTS




GGGSSTT



TTTT
S

S



TT
B
B
BB

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S



SSS

TT

TT



TTSSSSSS
GGG

B

SSSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TAWQVHRDWFNDLALPWKHEGARNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
B
T

S

TT

S
BT
SSS



SSS







TTTTTTS
SS

BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence YHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS


S
SSS
B

SS


SSS

SS
S


SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSYQWFQKGSSIGRVFQKTKKGIERLTVIGEHA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
B

SSSS

SS







S
TT




SSSSGGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence WDFGSAGGFLSSIGKALHTVLGGAFNSIFGGVGFLPKLLLGVALAWLGLNMRNPTMSMSFLLAGVLVLAM
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
TTSS

STTTSTTS

S
S
SSGGGTS
 ..
Sequence TL
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D