Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o6dB_

Fold library idPDB HeaderMoleculeTitle
c5o6dB_3.28PDB header: hydrolaseChain: B: PDB Molecule: atp-dependent dna helicase pif1;


Added to library: Sat Dec 16 08:34:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLAACNIGGITIHSFA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

T


STTSS
GGGSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence GIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFC
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T
TTS
S
TTS
SSGGGS
TT

STTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GDFFQLPPVSKPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTS









TTSS






TTTT
T


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SSSS

SSTTS
S


S
S
TSS
S
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VMMVKNLDATLVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSAVASRK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S

BTTB
TT

SS
TT

T
TTT


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence SSVKEGFAKSDIGEPVSPLDSSVFDFMKRVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSSS


SSS





GGGGTTT


TTS

TTTTTTS


TTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)




TT


S
S
STT

BSS
TT

STTTBS
STT
 .........500.........510.........520.......
Sequence QVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADE
Predicted secondary structure










SS confidence




































Known secondary structure (DSSP) S

GGG



TT


TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D