Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o5gA_

Fold library idPDB HeaderMoleculeTitle
c5o5gA_3.03PDB header: signaling proteinChain: A: PDB Molecule: roundabout homolog 1;


Added to library: Sat Jan 20 13:43:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)










SS




SS

TT


TTT
TTSS
TTS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTI
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)


SS


S

SS








TTS

S

 .........150.........160.........170.........180.........190.........200.........210
Sequence SWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLA
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TT

TTSSS
TTSS

GGG
SSS







 .........220.........230.........240.........250.........260.........270.........280
Sequence VTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEAS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT



S



TTS


TTT
TT


S

TTS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYSSSRFSVSQTGDLTIT
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)






TT




SS

TT



B





S
TTS

 .........360.........370.........380.
Sequence NVQRSDVGYYICQTLNVAGSIITKAYLEVTG
Predicted secondary structure






SS confidence






























Known secondary structure (DSSP) S

GGG

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D