Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o5cD_

Fold library idPDB HeaderMoleculeTitle
c5o5cD_2.10PDB header: lyaseChain: D: PDB Molecule: putative decarboxylase involved in desferrioxamine


Added to library: Sat Mar 3 08:45:56 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PHDFIFNDHQLSAWARQTEQVLALMTETVKGVEKPFSGILPHELAREFSGVDLDQGSNEAALEELKKLYL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTS
SSTT

SS




TT

TT


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RDAVWFHHPKYVAHLNCPVVLPSLLAEQIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLSRIGLPAGADGI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


TTSTTB
SSS






BTTSGGGTTT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTSGGTQSNLMAMLLARDSWCAAHHPGHLIKHRGLPHDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVIP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSSTT




TTGGGTTS
TTTS
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence VDYDERYRMDVDCLKQEVQRCLQQGLIPVAVVATSGTTDFGSIDPLGAISELCKHHGMWMHVDAAYGCGL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
B
TTS
B
TT
BS
TTT

B

T
TTGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LVSESHRPRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHHLSHVTEGTPNLVNKSIQTTRRFDALKM
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) GG
TTTGGGGTTGGG
S
S


SS
SSGGGGGGG





GGGG
S
SS
B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence WLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPALTDEINTNIRKAVFRS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S
S
TT



SSS


 .........430.........440.........450.........460........
Sequence GNAVIAGTKVNGRQYLKFTLLNPNTTAADIEDVIALIVHYGREQVRGP
Predicted secondary structure
















SS confidence















































Known secondary structure (DSSP) TS
B
TT


TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D