Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5o31b_

Fold library idPDB HeaderMoleculeTitle
c5o31b_4.13PDB header: oxidoreductaseChain: B: PDB Molecule: nadh dehydrogenase [ubiquinone] iron-sulfur protein 7,


Added to library: Sat Jan 20 09:47:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AERVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STTS
T
TT
-------------------------
 .........80
Sequence XXXXXXXXXX
Predicted secondary structure









SS confidence









Known secondary structure (DSSP) ----------


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D