Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nwsA_

Fold library idPDB HeaderMoleculeTitle
c5nwsA_2.23PDB header: biosynthetic proteinChain: A: PDB Molecule: saacmm;


Added to library: Sat Jan 27 10:03:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AGPHMMDPDLLADPFTGYGRLRERGPVVRGRFVDGTPVWFVTRYDDVRAVLRDPRFVNTPSNVPEPLRVY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


BTT


S
TTS

S
TTSS




TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLGSILDSDPPDHPRLRRLVTRAFAARRILGLRPGIERIADRLLAELPRREEEDGTVDLLEHFAYPLSIT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T
GGG

TTTTGGGGGGGG

TTS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence VICELVGIPATDLERWREWGGDLVSMRPERLRHSFPVMIDYCHRLIEQRRAALTDDLLSELIRAQDDDGG
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T

GGG

S

SS


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RLSDIETVTMILTLVLAGHETSAHLIGNGTAALLTHPGQWALLRKDPALLPRAVHELMRWCGSVHVARLR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


S
GGG
SB
B


 .........290.........300.........310.........320.........330.........340.........350
Sequence YATEDLELAGTPVARGDAVQLVLVSANFDPRHYSDPDRLDITRHQEGQAENHVGFGHGIHYCLGATLARQ
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SS
TT
TT
BT
TTTSSSTTS

TTSS
TT





TT

GGG

TT
 .........360.........370.........380.........390.....
Sequence EGEVALARLLETYPDLALADGDPEVRRARLPGSWRLDALRLRLRP
Predicted secondary structure
























SS confidence












































Known secondary structure (DSSP)
TT

SS
GGGGB


TTB

BS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D