Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nufA_

Fold library idPDB HeaderMoleculeTitle
c5nufA_1.80PDB header: oxidoreductaseChain: A: PDB Molecule: malate dehydrogenase 1, cytoplasmic;


Added to library: Sat Jan 13 08:20:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
TTTSTTTTT
TT



GGGTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALIL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TT
S

S



TT

S
TT

SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTS
GGG

T

GGG

B
SSTT

TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELVKDDAWLDGEFISTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTSS





TT



SGGG

 .........290.........300.........310.........320.........330.
Sequence SGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEELKEEKDLAYSCLS
Predicted secondary structure












SS confidence


















































Known secondary structure (DSSP) TTSTT






T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D