Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nufA_

Fold library idPDB HeaderMoleculeTitle
c5nufA_1.80PDB header: oxidoreductaseChain: A: PDB Molecule: malate dehydrogenase 1, cytoplasmic;


Added to library: Sat Jan 13 08:20:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
TTTSTTTTT
TT



GGGTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALIL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TT
S

S



TT

S
TT

SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTS
GGG

T

GGG

B
SSTT

TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELVKDDAWLDGEFISTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTSS





TT



SGGG

 .........290.........300.........310.........320.........330.
Sequence SGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEELKEEKDLAYSCLS
Predicted secondary structure












SS confidence


















































Known secondary structure (DSSP) TTSTT






T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D