Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nqaA_

Fold library idPDB HeaderMoleculeTitle
c5nqaA_1.90PDB header: transferaseChain: A: PDB Molecule: polypeptide n-acetylgalactosaminyltransferase 4;


Added to library: Sat Dec 23 08:39:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DLSRPLYKKPPADSRALGEWGKASKLQLNEDELKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TT
BSS





TTSTTGGG







SS
TTS
TT







T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KFNYRTLPTTSVIIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYISNLDRVR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


TTTS

SS

SBTTT
S


GGGTTTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LIRTNKREGLVRARLIGATFATGDVLTFLDCHCECNSGWLEPLLERIGRDETAVVCPVIDTIDWNTFEFY
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SS




SS

SS
TT
S
TT
TTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence MQIGEPMIGGFDWRLTFQWHSVPKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGE
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


SS


TT





SSTTS

SS

SS
TTSS
TT

SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NLELSFRVWQCGGKLEIHPCSHVGHVFPKNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TT






GGGSGGGGGS




 .........360.........370.........380.........390.........400.........410.........420
Sequence LRERLRCKSFDWYLKNVFPNLHVPEDRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQ
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT


T


-





TTSSSSTT



SS
TT
S



S

GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence FFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TT


SSS


TT

S



TTS


GGG


TTS
TTTT
T
 .........500.........510....
Sequence EGRPDVQMRTCDALDKNQIWSFEK
Predicted secondary structure











SS confidence























Known secondary structure (DSSP) TS



TT
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D