Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5no7B_

Fold library idPDB HeaderMoleculeTitle
c5no7B_3.01PDB header: oxidoreductaseChain: B: PDB Molecule: uncharacterized protein;


Added to library: Sat Jan 20 10:24:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HIAFWHNSMYGFNVTEQTFPYDNRPVVPLQYMTFQEWWFHNHLDYPPHPGDFFDFPAGKAATAELACNKG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TTBTTTT

TTTSSS


TTS
B
S

GGGG
TTS


TT

TTSSSGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATTWFNSSEGGNIQNGNDPCPGSPPSEYHTTGIDDVKGCAMAIAYESDVRKIKPEDFTVFSVNQTCVWYR
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) GSGGGGGSTT




TT
SSTTS
GGGGT
SSGGG




S
GGG

TTT
SS
SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTDFQVPERMPPCPPGGCHCAWFWIHSPDSGGEQIYMNGFQCNITGSTSHVPLAKPKVARRCGADPDHGK
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

TT




TT



TTSS


BS





B


B




S

GGGS
 .........220.........230.........240.........250.........260.........270
Sequence PDAVPGNCTYGAKQPLYWLQKEGNNEFDDYIAPPFYNDLYNFKDGAQNDIFVDSYPDGIP
Predicted secondary structure




















































SS confidence



























































Known secondary structure (DSSP)
S

GGG


S
B




SSSS

S



TTS


SSGGGT

S
TT
BTTTSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D