Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5no7B_

Fold library idPDB HeaderMoleculeTitle
c5no7B_3.01PDB header: oxidoreductaseChain: B: PDB Molecule: uncharacterized protein;


Added to library: Sat Jan 20 10:24:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HIAFWHNSMYGFNVTEQTFPYDNRPVVPLQYMTFQEWWFHNHLDYPPHPGDFFDFPAGKAATAELACNKG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TTBTTTT

TTTSSS


TTS
B
S

GGGG
TTS


TT

TTSSSGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATTWFNSSEGGNIQNGNDPCPGSPPSEYHTTGIDDVKGCAMAIAYESDVRKIKPEDFTVFSVNQTCVWYR
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) GSGGGGGSTT




TT
SSTTS
GGGGT
SSGGG




S
GGG

TTT
SS
SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTDFQVPERMPPCPPGGCHCAWFWIHSPDSGGEQIYMNGFQCNITGSTSHVPLAKPKVARRCGADPDHGK
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

TT




TT



TTSS


BS





B


B




S

GGGS
 .........220.........230.........240.........250.........260.........270
Sequence PDAVPGNCTYGAKQPLYWLQKEGNNEFDDYIAPPFYNDLYNFKDGAQNDIFVDSYPDGIP
Predicted secondary structure




















































SS confidence



























































Known secondary structure (DSSP)
S

GGG


S
B




SSSS

S



TTS


SSGGGT

S
TT
BTTTSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D