Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nmpF_

Fold library idPDB HeaderMoleculeTitle
c5nmpF_2.65PDB header: hydrolaseChain: F: PDB Molecule: isatin hydrolase;


Added to library: Sat May 19 10:22:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TTPTILPALAAGLARGNIRVVDLTQTLSPSFPTLQLPSQFGQVQPFKIERISHYDASGPAWYWNNFSCGE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)



TSS
B



TTS





TTS





TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence HTGTHFDAPAHWITGRDYPGNSVDTIAPENFVAPAVVIDASAQVRENEDWLLTVDFLQAWEQRHGRIPAG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TSSS
GGGSGGGTTSTT
STTTS
GGGG

TT





TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AWVLFRTDWSLRVGDAAAFLNIREDGAHTPGPTQEAVEWLIGERNVHGFGVETINTDAGQSYAWPLAYPC
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


GGGGTT

TT



TT

S
SSS
SS
GGGGSSSSSS
 .........220.........230.........240.........250.........260
Sequence HTLMHGANRYGLQCLKNLDQLPPRGAFILAAPLKIEGGSGSPLRVLALVE
Predicted secondary structure





















SS confidence

















































Known secondary structure (DSSP) TT
SB

GGGS
SS






TT
S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D