Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nm7A_

Fold library idPDB HeaderMoleculeTitle
c5nm7A_1.72PDB header: hydrolaseChain: A: PDB Molecule: peptidoglycan-binding domain 1;


Added to library: Sat Feb 17 08:25:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KTLRLGDRGADVSYLQRQLIAAGARLDIDAIYGSATRDAVMAFQATHGLVADGIAGPKTWSTLSAGRRDP
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

B
TT
BSTT




SSB

TTS


S
B




T
 .........80.........90.........100.........110.........120.........130.........140
Sequence RHLTDADLQRAADRLQVDLAAVRAVNEVESKGAGFLPDGRPVILYERHIMYRQLAAAGDALAAKYPALVN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS

T

S
S
SB
TTSSB




TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SKRGGYAGDAAEYARLASASQISGACALEATSWGAFQIMGFHWKALGYPDVFAFVDAMKVSEAEQLEAFV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS





TT
TTTTTGGGGTTTT
SS
 .........220.........230.........240.........250.........260.
Sequence RFVLADKVMLAALRSKKWAKFAELYNGKAYAENLYDVKLERAFDRYSRAGG
Predicted secondary structure













SS confidence


















































Known secondary structure (DSSP) T
TT

TTGGGGT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D