Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nlmB_

Fold library idPDB HeaderMoleculeTitle
c5nlmB_2.14PDB header: transferaseChain: B: PDB Molecule: indoxyl udp-glucosyltransferase;


Added to library: Sat Feb 3 08:30:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTTAPPPHVIIVPSAGMGHLIPLAEFAKRLLPRFTFTFAVPTSGPPSSSQRDFLSSLPASIDTSFLPEVD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


S




SSTTTT


SSS

TS
TT




 .........80.........90.........100.........110.........120.........130.........140
Sequence LSDAPSDAQIETLMSLMVVRSLPSLRDLIASYSASGRRVAALVVDLFATDAIDVALELGIRPFIFFPSTA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTS
TT

TTTSS


TT
GGGTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence MTLSFFLHLEKLDETVSCEFAEPVQIPGCIPVHGKDLIDPVQDRKNDAYKWLLHHSKRYKLAEGVIVNSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
TT

B

TTS

B
GGGS
GGGT
TTSTGGGSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence EGLEGGPIRELLHPEPGKPRVYPVGPLIQAARPECLKWLDQQPRGSVLFVNFGSGGVLSTEQQNELAGVL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT
S

TTS









TTGGGS
TT


TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence AHSQQRFLWVVRPPNDGIANDPLKLLPEGFLEQTAGRGLVLPMWAPQIDVLSHESTGGFLTHCGWNSTLE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
S



TT
TT

TTTTS
TTTTTTTTTTS


STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence SVFHGVPLITWPLYAEQKMNAVMLTEGLRVGLRPSVGKDGIIRGAEIARVIGELMEGEEGKRIRSKMQEL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




STTTTS






TTS


SS
 .........430.........440........
Sequence KRAASAVLSKDGSSTRALEEVAKIWESK
Predicted secondary structure




SS confidence



























Known secondary structure (DSSP) TSSSSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D