Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nlmB_

Fold library idPDB HeaderMoleculeTitle
c5nlmB_2.14PDB header: transferaseChain: B: PDB Molecule: indoxyl udp-glucosyltransferase;


Added to library: Sat Feb 3 08:30:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTTAPPPHVIIVPSAGMGHLIPLAEFAKRLLPRFTFTFAVPTSGPPSSSQRDFLSSLPASIDTSFLPEVD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


S




SSTTTT


SSS

TS
TT




 .........80.........90.........100.........110.........120.........130.........140
Sequence LSDAPSDAQIETLMSLMVVRSLPSLRDLIASYSASGRRVAALVVDLFATDAIDVALELGIRPFIFFPSTA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTS
TT

TTTSS


TT
GGGTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence MTLSFFLHLEKLDETVSCEFAEPVQIPGCIPVHGKDLIDPVQDRKNDAYKWLLHHSKRYKLAEGVIVNSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
TT

B

TTS

B
GGGS
GGGT
TTSTGGGSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence EGLEGGPIRELLHPEPGKPRVYPVGPLIQAARPECLKWLDQQPRGSVLFVNFGSGGVLSTEQQNELAGVL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT
S

TTS









TTGGGS
TT


TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence AHSQQRFLWVVRPPNDGIANDPLKLLPEGFLEQTAGRGLVLPMWAPQIDVLSHESTGGFLTHCGWNSTLE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
S



TT
TT

TTTTS
TTTTTTTTTTS


STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence SVFHGVPLITWPLYAEQKMNAVMLTEGLRVGLRPSVGKDGIIRGAEIARVIGELMEGEEGKRIRSKMQEL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




STTTTS






TTS


SS
 .........430.........440........
Sequence KRAASAVLSKDGSSTRALEEVAKIWESK
Predicted secondary structure




SS confidence



























Known secondary structure (DSSP) TSSSSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D