Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nl7A_

Fold library idPDB HeaderMoleculeTitle
c5nl7A_2.48PDB header: structural proteinChain: A: PDB Molecule: calponin homology domain protein putative;


Added to library: Sat May 19 08:28:01 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ADSELVAQWEKVQIKTFTKWVNMHLAKKGRKINDVTTDFKNGVELCALLEIIGETTIKCVTNPKMRIQMT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

GGGT


S
TTTST





SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ENLDKALRFIQSRDVKLTGIGPTDIVDGNVKLTLGLVWTLILRFAISELSAEGLSAKQGLLLWCQKKCEP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT


SS

TT
TSGGG

SSS
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YPVKVENFSESFKDGKVFCALIHRHRPDLLDWETVGEDDRANLEKAFDVAEKELGIPKLLDVDDIVNMPR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS




SSGGGTTS
TTS

GGG

S
T




S
SSS
 .........220.........230
Sequence PDERSVMTYVAALYKVFSSN
Predicted secondary structure



SS confidence



















Known secondary structure (DSSP)






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D