Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nijB_

Fold library idPDB HeaderMoleculeTitle
c5nijB_2.75PDB header: ligaseChain: B: PDB Molecule: vacuolar-processing enzyme gamma-isozyme;


Added to library: Sat Mar 3 08:33:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FQSGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDDIANNYENPRPGTIINSPHGK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


S




SGGGTTT

GGG



STT
TT
SSTT


SSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence DVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSHGGPGVLGMPTSPYLYAN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


TT


SB
GGG
ST
TTT

SS







TT


TT

SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLNDVLKKKHALGTYKSLVFYLEAESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYET
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

S


GGGGTTTT

SSSSSS
SSS

BS
SS
SSS

SS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence CLGDLYSVAWMEDSGMHNLQTETLHQQYELVKRRTAPVGYSYGSHVMQYGDVGISKDNLDLYMGTNPAND
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
TTT
BS

SSS





GGGGGSBT


SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence NFVTNQRDADLVHFWEKYRKAPEGSARKTEAQKQVLEAMSHRLHIDNSVILVGKILFGISRGPEVLNKVR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)



BS
TT

TTT


 .........360.........370.........380.........390.........400.........410.........420
Sequence SAGQPLVDDWNCLKNQVRAFERHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTTLPTGPWSSL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TTS
S
S



GGGTT


SS


SSSS

 ......
Sequence NRGFSA
Predicted secondary structure





SS confidence





Known secondary structure (DSSP) TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D