Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ngjB_

Fold library idPDB HeaderMoleculeTitle
c5ngjB_2.20PDB header: viral proteinChain: B: PDB Molecule: tail tube protein;


Added to library: Sat Jan 6 08:16:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RNTRIFVSTVKTGHNKTNTQEILVQDDISWGDSNSTDITVNEAEWSFSTYILPYKDKNTSKQIVPDYMLW
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
SSS

TTT

SS




S

S






TTT


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HALSSGRAINLEGTTGAHNNATNFMVNFKDNSYHELAMLHIYILTDKTWSYIDSCQINQAEVNVDIEDIG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SS


TTSSS
SS

TT

SSS


TT

TTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RVTWSGNGNQLIPLDEQPFDPDQIGIDDETYMTIQGSYIKNKLTILKIKDMDTNKSYDIPITGGTFTINN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS
SS
S

T
S

S

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NITYLTPNVMSRVTIPIGSFTGAFELTGSLTAYLNDKSLGSMELYKDLIKTLKVVNRFEIALVLGGEYDD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


SS


SS

S
S





SSS

T


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ERPAAILVAKQAHVNIPTIETDDVLGTSVEFKAIPSDLDAGDEGYLGFSSKYTRTTINNLIVNGDGATDA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

TTTTT
SSS


SSTT


S

S
TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence VTAITVKSAGNVTTLNRSATLQMSVEVTPSSARNKEVTWAITAGDAATINATGLLRADASKTTVEATAKD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


STT




SS


STT
S


SS
SS

SSS
GGG


SS
 .........430..
Sequence GSGVKGTKVITV
Predicted secondary structure



SS confidence











Known secondary structure (DSSP) SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D