Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nfqA_

Fold library idPDB HeaderMoleculeTitle
c5nfqA_1.60PDB header: hydrolaseChain: A: PDB Molecule: epoxide hydrolase belonging to alpha/beta hydrolase


Added to library: Sat May 19 11:22:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTFELKRVALPNGIHLDVVDEGPTDAPVLIFLHGFPESHRTWRHQIRHFSDRFRCIAPDQRGYRGSSKPQ
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




TTS
S
TTS


TT

GGGGTTTS
TTSTTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence EVAAYTPDKLIGDIFLLADTLGIGSFTIVGHDWGGAIAWGVALGGQHLRVERAIIANAPHPAIFQKLLYT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SGGGG
TT
S
TBTTTS


TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HPVQREASQYIRGFRDPANDALVKEHGLTGLLMKEVKWDRPSAMEPEERDQLLRDWQNHDAAFGMLNYYR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TT
GGG
TTS






TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ASPIDVPTMDAPFKVPAGYTPPQLPRLTIPTLVIWALDDLALPPENLEGLEEIIDPLTIVRVPDCGHFVP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)






TTS
SS

TT







B
S
TT
SSS
GGGGTTBSSSS

S
 .........290........
Sequence WEAPDAVNAAMEGFLAGH
Predicted secondary structure


SS confidence

















Known secondary structure (DSSP) S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D