Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nf8A_

Fold library idPDB HeaderMoleculeTitle
c5nf8A_UNKPDB header: membrane proteinChain: A: PDB Molecule: respiratory supercomplex factor 1, mitochondrial;


Added to library: Sat Mar 3 08:37:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKAQYYFRWRVGL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT







TTTSS

S

S
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEETEARRKRAELARMKTLENEE
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)




SSS








T
 .........150.........
Sequence EIKNLEKELSDLENKLGKK
Predicted secondary structure


SS confidence


















Known secondary structure (DSSP) T
-


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D