Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nf4B_

Fold library idPDB HeaderMoleculeTitle
c5nf4B_1.75PDB header: cell adhesionChain: B: PDB Molecule: minor fimbrium tip subunit mfa3;


Added to library: Sat Feb 10 08:25:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PDVYLLVNARAADFEDRVHSLAMLVFDSNTGEKVAEHFSSSIGSGTSTYVFTVKLKPGQRDFFFVANIPN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




GGG


TTT
B

SSS




S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MQTAMASIVNKSDMNHFMQVFRDLDPIHYHNATNNNGFPMSRMYSNQTVTIGGTITQPLPFKPDGENNVK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

B



GGGGT


SS




SB

SSS


GGG
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LQRVVAKLDVNIVEGVENLQKIELCNANVHYRLVPNQSEPIQFYGPVELRRVGATNQWLGYMPEAIVEST
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S
GGGS
BS
SS


S

S
B




TTSS
B


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KWWGNTGNAENKPINFFRLTTRGGLVYDVPIITHEGAIPGGQYLPFAKGLLADKPSYTVYRNRHYIYRIK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
BTTBSSSTT
TT

SS



B

S

TTS
TT
SSS

B

B
TT
 .........290.....
Sequence TLPDKIEVKYSICDW
Predicted secondary structure






SS confidence














Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D