Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nf4B_

Fold library idPDB HeaderMoleculeTitle
c5nf4B_1.75PDB header: cell adhesionChain: B: PDB Molecule: minor fimbrium tip subunit mfa3;


Added to library: Sat Feb 10 08:25:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PDVYLLVNARAADFEDRVHSLAMLVFDSNTGEKVAEHFSSSIGSGTSTYVFTVKLKPGQRDFFFVANIPN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




GGG


TTT
B

SSS




S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MQTAMASIVNKSDMNHFMQVFRDLDPIHYHNATNNNGFPMSRMYSNQTVTIGGTITQPLPFKPDGENNVK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

B



GGGGT


SS




SB

SSS


GGG
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LQRVVAKLDVNIVEGVENLQKIELCNANVHYRLVPNQSEPIQFYGPVELRRVGATNQWLGYMPEAIVEST
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S
GGGS
BS
SS


S

S
B




TTSS
B


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KWWGNTGNAENKPINFFRLTTRGGLVYDVPIITHEGAIPGGQYLPFAKGLLADKPSYTVYRNRHYIYRIK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
BTTBSSSTT
TT

SS



B

S

TTS
TT
SSS

B

B
TT
 .........290.....
Sequence TLPDKIEVKYSICDW
Predicted secondary structure






SS confidence














Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D