Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ncdA_

Fold library idPDB HeaderMoleculeTitle
c5ncdA_2.45PDB header: hydrolaseChain: A: PDB Molecule: peptidoglycan n-acetylglucosamine deacetylase;


Added to library: Sat Feb 24 08:33:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKVAYLTFDDGPGKYTAELLNTLKQHDAKATFFLIGANVKEFPDLVKRENAEGHYVGMHSMTHNFAKLYK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



TTTTT




TT


SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NGEYVNEMKEDQGLIANIIGKSPKLTRPPYGSMPGLNEGLRNKVVEGGFKVWDWTIDSLDWRYNKMPVDA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

SS




TT
STTTS
TT
B

S

GGGGTTS
 .........150.........160.........170.........180.........190.........200......
Sequence AAAQIAQNVLTNATKPQEVILMHDIHPQSVAAVPAILKGLKEKGYEFEAYHEESHFPVNFWHDNRM
Predicted secondary structure



















SS confidence

































































Known secondary structure (DSSP) T

SSTTSTTT






GGG


B
TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D