Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n8nR_

Fold library idPDB HeaderMoleculeTitle
c5n8nR_3.28PDB header: structural proteinChain: R: PDB Molecule: evpb family type vi secretion protein;


Added to library: Sat Jan 13 08:20:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence REAVETAVRTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNN
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

SSSS
S

S

GGGGTST
 .........80.........90.........100.........110.........120.........130.........140
Sequence TETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S

SSS








S
GGGGGS





STT






SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


GGGGT
SSSSSTTS
S
STTGGGSGGGTSSSGGG

S
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence LARLPYGAKTDPVEEFAFEEETDGADSSKYAWANSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPA
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) B
S


SSSSS

SSS






SS
SSSS
B

TSSSS


STTTT

S


 .........290.........300.........310.........320.........330.........340.........350
Sequence HTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STT


SBSS


TT



TTSS
S

BBS





SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTBTTS


TTSB
STTSSS
SSS
 .........430.........440.........450.........460.
Sequence EEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA
Predicted secondary structure
















SS confidence








































Known secondary structure (DSSP)
TTSSS














SS
TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D