Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n8nR_

Fold library idPDB HeaderMoleculeTitle
c5n8nR_3.28PDB header: structural proteinChain: R: PDB Molecule: evpb family type vi secretion protein;


Added to library: Sat Jan 13 08:20:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence REAVETAVRTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNN
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

SSSS
S

S

GGGGTST
 .........80.........90.........100.........110.........120.........130.........140
Sequence TETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S

SSS








S
GGGGGS





STT






SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


GGGGT
SSSSSTTS
S
STTGGGSGGGTSSSGGG

S
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence LARLPYGAKTDPVEEFAFEEETDGADSSKYAWANSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPA
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) B
S


SSSSS

SSS






SS
SSSS
B

TSSSS


STTTT

S


 .........290.........300.........310.........320.........330.........340.........350
Sequence HTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STT


SBSS


TT



TTSS
S

BBS





SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTBTTS


TTSB
STTSSS
SSS
 .........430.........440.........450.........460.
Sequence EEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA
Predicted secondary structure
















SS confidence








































Known secondary structure (DSSP)
TTSSS














SS
TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D