Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n7nB_

Fold library idPDB HeaderMoleculeTitle
c5n7nB_2.30PDB header: hydrolaseChain: B: PDB Molecule: putative cathepsin d;


Added to library: Sat Dec 30 08:33:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AFRIPLTRFKSVRKQLAEEGIYIHEGPYPEPLVNLLDVVYYGPISIGTPPQDFQVIFDTGSANLWLPSSK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



TT







SS



TTT

TTTTTT


BTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CTTKYCLHHHRYDSSKSSTYEADGRNFTIVYGSGNVEGFISKDVCRIGSAKVSGQPLGEALVVGGESLLE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

STS

B
GGG
TT


TTS
TT

TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence APFDGILGLAYPSIAVDGVVPVFDNMMKQGLLGEQNVFSVYLNRDPSSKEGGEVLFGGIDHDHYKGSITY
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
S


S
GGGS
TT


TT
S
S




SS
S

T


GGGB
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence VPVTAKGYWQFHVDGVKSVSASKSAPELLCKDGCEAIANTGTSLITGPPEEVDSLNQYLGGTKTEGGQYL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT


TTSSS
STT

TT

S
TT

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LDCDKLESLPNVTFTISGKEFSLRSKDYVLKVNQQGQTLCVSGFMGLEMPQPLWILGDVFLGPYYTIFDR
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT

TT


TT
TTS


SS


TTT
 .........360.
Sequence DQDRVGFAEVA
Predicted secondary structure




SS confidence










Known secondary structure (DSSP) TTTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D