Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n5fC_

Fold library idPDB HeaderMoleculeTitle
c5n5fC_2.06PDB header: oxidoreductaseChain: C: PDB Molecule: encapsulated ferritin;


Added to library: Sat Jan 27 08:17:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QLHEPAELLSEETKNMHRALVTLIEELEAVDWYQQRADACSEPGLHDVLIHNKNEEVEHAMMTLEWIRRR
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

SS
GGGS



T
 .........80.........90..
Sequence SPVFDAHMRTYLFTERPILELE
Predicted secondary structure









SS confidence





















Known secondary structure (DSSP)
SS

S
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D