Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n4aA_

Fold library idPDB HeaderMoleculeTitle
c5n4aA_1.79PDB header: transport proteinChain: A: PDB Molecule: intraflagellar transport protein 80;


Added to library: Sat Mar 3 09:41:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRLKVKQSELTAAVGWNVWNELFTCSDDQTIHKWNMLGEPEQKVSTLDAYFTDMHWYPVSSKKTQAGGTD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




TTS
TTS
TTS

SS



S
GGG

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence VFAVACTDGSVKILSRTGRVEKSIEGHKGACISLRWSYDGTALATAGEDGSVKIWSRNGMLRSTLAQADS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTSTT



SS

TTSS
TTS
TTS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PVYSIVWAYDCDQLCYCTGSNVVIKSLSSNAKQNAWKAHDGVVLKVDWSPINHLIITGGEDCKYKVWDSF
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




TTSSTTSS

S


SSS

TTT

TTS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GRLLFQSGLFDYPVTSVAWAPSGELFAVGGFNTLQLCDRMGWAYSKIHLNDTGSIMTLSWTADSTQLAGG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S




SS



TTSSBTTTS

SS

B
TTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GGSGGVVFGQVVDLALEDGKMQVTVVDDMRIVVNDILNENADELPEFRDRVIKVSLGYGYLIVATATQCH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTS

TTTTGGGT





SS
TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VYNTTNLGTPHIFDLKDTVTLLLQAERHFLLLDNSAGIQIYTYEGRQICNPRFQGLRTELLNAQMITLSN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
TTS

SS


TT
SSS

TTS




TT

GGG

TTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence DTIAVLDQQASGTTVRFFDTAQGRPVGEPWQHTLEVKEIALSQAGTINDRQLIVIDRNRDLYLLPVMKRH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
SS
TTT

B
SS

SS


SS
GGG
TT

SSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence VAKLAAMCDSARWHDSTAMLSAMVDQRLCVWYYPSEVYVDKDLLAKTRYTKSDSDFGKSAQIQLFAGNRC
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SS
SSSS
TTS
GGGGGT
T
TT



TT
TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence LVRRSDGVLVSAATSPYPAVLYDMIRKQQWDKATRLCRFIKDPTMWATLAAMAMAAKELNTAEVAFAAID
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
TTS


SSTT


T
 ...
Sequence EVD
Predicted secondary structure


SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D