Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n3uA_

Fold library idPDB HeaderMoleculeTitle
c5n3uA_1.89PDB header: lyaseChain: A: PDB Molecule: phycocyanobilin lyase subunit alpha;


Added to library: Sat Dec 9 08:29:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PSVEEFPAENGPQLTPELAIANLQSSDLSLRYYAAWWLGKYRVKESAAVDALIAALEDEADRTELGGYPL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



SS
S
SSS


TT
S
TT


TT

S


GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence RRNAARALGKLGNRKAVPGLINCLECPDFYVREAAAQSLEMLKDKTAAPALIKLLDGGVAQAVQVTGRPH
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT
GGGTT
SST
GGGTTTTTGGG



TT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LVQPYEAVLEALGAIGATDAIPLIQPFLEHPVSRVQCAAARAMYQLTQEPVYGELLVKVLAGNDLNLRRV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SS
TT
GGGGGGGG
SS

TSS
 .........220.........230.........240.........250.........260......
Sequence ALGDLGAIGYLAAAEAIANAKAENSFKLIALKGLLEHQMSISDQAIRVMNLMDSLL
Predicted secondary structure












SS confidence























































Known secondary structure (DSSP) T
GGGSSS
T



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D