Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n2uC_

Fold library idPDB HeaderMoleculeTitle
c5n2uC_2.40PDB header: viral proteinChain: C: PDB Molecule: nucleoprotein;


Added to library: Sat Mar 3 08:32:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPEEQRAKNAKTILENIQIYERMCDLFGVSEDDKLIIENSISIERMIRVVTDKKYQDKKLKNAIANAGKV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
TT

TTGGGBT







 .........80.........90.........100.........110.........120.........130.........140
Sequence FCRLVESTAGKCSARLGMALKPNVEAVLTDVLGAVLGKRMGFTAMFKSNLEEVLYQRKRNSAETFTLSQG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT








S
GGGGGG
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASLEARFRPIMEKHLGVGTVVASIKNILASKKNPLEREISFLNKKLFPGPMRQLCKKFEYLNDQEKQLAL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTTTGGG

TT

S
SSTTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLMLDASLILKPQVTHKMIMPWSMWLAVKKYAEMNKGSPSLEDLAAYSGVRAFMAFNTACYMSKFTIGKG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTS










SSSS

TGGG

SSS
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVGDAEIMENGNDKMQILAMACFGLAYEDTGIVAAMISQPMKKRYQLKVGNFNPPEEGTIKGTSAGYFHK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS
TTSB

T
TTS
TTBSS



GGG




SS

S

TT
BS
 .........360.........370.........380.........390.........400.........410.........420
Sequence WAEFGNRLPFNSFGTGESKQISNSGVFAVQRPSTTNIQRLAELMARNTGETSDNFTQLVQKIREQVGTFA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




S
TTSB
SS


S






S











TT

 .........430.........440.........450.........460.......
Sequence DQKANLREFTGGYIYDITDVTKSNPKIPQLGGNSFFFEFTGSDVPRT
Predicted secondary structure



























SS confidence














































Known secondary structure (DSSP) TTT

SSBT

BTT

S

S
B




S


TT


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D