Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n2uC_

Fold library idPDB HeaderMoleculeTitle
c5n2uC_2.40PDB header: viral proteinChain: C: PDB Molecule: nucleoprotein;


Added to library: Sat Mar 3 08:32:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPEEQRAKNAKTILENIQIYERMCDLFGVSEDDKLIIENSISIERMIRVVTDKKYQDKKLKNAIANAGKV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
TT

TTGGGBT







 .........80.........90.........100.........110.........120.........130.........140
Sequence FCRLVESTAGKCSARLGMALKPNVEAVLTDVLGAVLGKRMGFTAMFKSNLEEVLYQRKRNSAETFTLSQG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT








S
GGGGGG
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASLEARFRPIMEKHLGVGTVVASIKNILASKKNPLEREISFLNKKLFPGPMRQLCKKFEYLNDQEKQLAL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTTTGGG

TT

S
SSTTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLMLDASLILKPQVTHKMIMPWSMWLAVKKYAEMNKGSPSLEDLAAYSGVRAFMAFNTACYMSKFTIGKG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTS










SSSS

TGGG

SSS
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVGDAEIMENGNDKMQILAMACFGLAYEDTGIVAAMISQPMKKRYQLKVGNFNPPEEGTIKGTSAGYFHK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS
TTSB

T
TTS
TTBSS



GGG




SS

S

TT
BS
 .........360.........370.........380.........390.........400.........410.........420
Sequence WAEFGNRLPFNSFGTGESKQISNSGVFAVQRPSTTNIQRLAELMARNTGETSDNFTQLVQKIREQVGTFA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




S
TTSB
SS


S






S











TT

 .........430.........440.........450.........460.......
Sequence DQKANLREFTGGYIYDITDVTKSNPKIPQLGGNSFFFEFTGSDVPRT
Predicted secondary structure



























SS confidence














































Known secondary structure (DSSP) TTT

SSBT

BTT

S

S
B




S


TT


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D