Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n1tM_

Fold library idPDB HeaderMoleculeTitle
c5n1tM_2.60PDB header: oxidoreductaseChain: M: PDB Molecule: copc;


Added to library: Sat Mar 3 08:55:14 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HAHLRAADPPEAIVDAAGLREIRLVFSEPVVDRFSTFRAFRLSLPENGIRNLTQLNTLASELGVDTEESA
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)


S
SS

TT

SS


TTT



TT


ST

SS

S
S
 .........80.........90.........100.........110.........120....
Sequence HHEVELESDLSAEVTLHSDEPLPAGAYAVVWRVLSVDGHTTTGFHAFVHAGGTA
Predicted secondary structure



























SS confidence





















































Known secondary structure (DSSP) S





SS


S
TTS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D