Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n1tA_

Fold library idPDB HeaderMoleculeTitle
c5n1tA_2.60PDB header: oxidoreductaseChain: A: PDB Molecule: flavin-binding subunit of sulfide dehydrogenase;


Added to library: Sat Mar 3 08:51:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AQRVVVIGGGFGGSTCARYLRHFDPDLEVTLINPSDTYTTCPFSNLVLGGERDLASITHDLSQLEHHHGV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



S
TTS
S
S
STTTTSS
SGGGSTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence RLVQRWVESIDADGHRVVLDDGSAIGYDRLVVSPGIDLRWDAVEGYDQAAQEAMPHAWRPGEQTLLLRRQ
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
S
TTTTTTS

S



TTSSBT
SGGGGTTS


SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEAMSDGGVVVIAPPANPFRPPGPYERASLIAHYLKHHKPRSKILILDAKDAFAKQGLFQTGWETLYPGM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TT


SSS




TT

SSS

TTSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IEWVPGIEGGTVERVDAATGEVFTPSGRYRGDVVNLIPPQHAGAIARNTGLTDDSGWCPVNQQTFESLQI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGT



TTTTTT
S



TT


TTSSB
B
TTT
BBSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PHIHVIGDASIAGAMPKAGFAANSQAKVCAAAVVAALHGFDPTEPSWSSTCYSLVGPEYGISVSAVYRLD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
GGGB

TT

S
TT






TTS
 .........360.........370.........380.........390..
Sequence NGSIVASEGAGVSPGEADDHFRQLEAVYARGWYDNITAEMYG
Predicted secondary structure
















SS confidence









































Known secondary structure (DSSP) SSS
TT


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D