Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n1tA_

Fold library idPDB HeaderMoleculeTitle
c5n1tA_2.60PDB header: oxidoreductaseChain: A: PDB Molecule: flavin-binding subunit of sulfide dehydrogenase;


Added to library: Sat Mar 3 08:51:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AQRVVVIGGGFGGSTCARYLRHFDPDLEVTLINPSDTYTTCPFSNLVLGGERDLASITHDLSQLEHHHGV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



S
TTS
S
S
STTTTSS
SGGGSTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence RLVQRWVESIDADGHRVVLDDGSAIGYDRLVVSPGIDLRWDAVEGYDQAAQEAMPHAWRPGEQTLLLRRQ
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
S
TTTTTTS

S



TTSSBT
SGGGGTTS


SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEAMSDGGVVVIAPPANPFRPPGPYERASLIAHYLKHHKPRSKILILDAKDAFAKQGLFQTGWETLYPGM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TT


SSS




TT

SSS

TTSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IEWVPGIEGGTVERVDAATGEVFTPSGRYRGDVVNLIPPQHAGAIARNTGLTDDSGWCPVNQQTFESLQI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGT



TTTTTT
S



TT


TTSSB
B
TTT
BBSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PHIHVIGDASIAGAMPKAGFAANSQAKVCAAAVVAALHGFDPTEPSWSSTCYSLVGPEYGISVSAVYRLD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
GGGB

TT

S
TT






TTS
 .........360.........370.........380.........390..
Sequence NGSIVASEGAGVSPGEADDHFRQLEAVYARGWYDNITAEMYG
Predicted secondary structure
















SS confidence









































Known secondary structure (DSSP) SSS
TT


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D