Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n0sA_

Fold library idPDB HeaderMoleculeTitle
c5n0sA_1.95PDB header: transferaseChain: A: PDB Molecule: peptide n-methyltransferase;


Added to library: Sat Feb 17 08:24:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TKAGSLTIVGTGIESIGQMTLQALSYIEAAAKVFYCVIDPATEAFILTKNKNCVDLYQYYDNGKSRLNTY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S

BSSTTTTS

S
S

SSGGGG

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence TQMSELMVREVRKGLDVVGVFAGHPGVFVNPSHRALAIAKSEGYRARMLPGVSAEDCLFADLCIDPSNPG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
SBSTTSS
STT





T

TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CLTYEASDFLIRDRPVSIHSHLVLFQVGCVGIADFNFTGFDNNKFGVLVDRLEQEYGAEHPVVHYIAAMM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT



TTS
TTS
S




TT



TT
TTS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PHQDPVTDKYTVAQLREPEIAKRVGGVSTFYIPPKARKASNLDIIRRLELLPAGQVPDKKARIYPANQWE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTS

TGGGGSTT

TT


SS




TT

SSS



TT


SS

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PDVPEVEPYRPSDQAAIAQLADHAPPEQYQPLATSKAMSDVMTKLALDPKALADYKADHRAFAQSVPDLT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT




SS
TTTT



TT


B





TT

 .........360.........370.........380.........390.........400.
Sequence PQERAALELGDSWAIRCAMKNMPSSLLDAARESGEEASQNGFPWVIVVGVI
Predicted secondary structure

















SS confidence


















































Known secondary structure (DSSP) T
B


SSS











STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D