Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n0lC_

Fold library idPDB HeaderMoleculeTitle
c5n0lC_1.68PDB header: transcriptionChain: C: PDB Molecule: gtp-sensing transcriptional pleiotropic repressor cody;


Added to library: Sat Feb 17 08:20:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MASEVLQKTRKINKTLQTSGGSSVSFDLLAGALGDVLSSNVYVVSAKGKVLGLHLNDVQDSSVIEDEYTK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


T
S




TSTTSB
SSGGG



TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QKKFSDEYTQNVLKIDETLENLNGEKILEIFPEEHGRLQKYTTVVPILGSGQRLGTLVLSRYSNSFNDDD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


T

S

GGG
TT
TT
TTTTSS


 .........150.......
Sequence LVIAEYSATVVGLEILI
Predicted secondary structure

SS confidence
















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D