Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mzvC_

Fold library idPDB HeaderMoleculeTitle
c5mzvC_2.80PDB header: cytokineChain: C: PDB Molecule: interleukin-23 receptor;


Added to library: Sat Jan 6 08:40:14 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SS


SS
STT



TT


S
TT

SSTTSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence EPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S
TT
SS





TT



S


S

 .........150.........160.........170.........180.........190.........200.........210
Sequence SLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTT

SS
GGG

S
STT


TTTS




S
 .........220.........230.........240.........250.........260.........270.........280
Sequence TVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS




SSTT






TTS


SS

TT
S
 .........290...
Sequence WQPWSSLFFHKTP
Predicted secondary structure








SS confidence












Known secondary structure (DSSP)













Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D