Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mzsA_

Fold library idPDB HeaderMoleculeTitle
c5mzsA_2.67PDB header: membrane proteinChain: A: PDB Molecule: ferric enterobactin receptor;


Added to library: Sat Feb 17 12:49:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VVATAQEETKQAPGVSIITAEDIAKRPPSNDLSQIIRTMPGVNLTGNSSSGQRGNNRQIDIRGMGPENTL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



GGGSTTS

SSSTTTSTT
S
TT
TTTTS
TTS
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ILVDGKPVSSRNSVRYGWRGERDSRGDTNWVPADQVERIEVIRGPAAARYGNGAAGGVVNIITKQAGAET
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TT

GGGGS
B
TTS
BS


SS
SS
GGGGGGGGGG
TT
SS



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence HGNLSVYSNFPQHKAEGASERMSFGLNGPLTENLSYRVYGNIAKTDSDDWDINAGHESNRTGKQAGTLPA
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) SSTTS

SSSS



TTTTTTT


B
GGGTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence GREGVRNKDIDGLLSWRLTPEQTLEFEAGFSRQGNIYTGDTQNTNSNNYVKQMLGHETNRMYRETYSVTH
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)


TT




SSS


TTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence RGEWDFGSSLAYLQYEKTRNSRINEGLAGGTEGIFDPNNAGFYTATLRDLTAHGEVNLPLHLGYEQTLTL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TT
BBSSGGGBTSB
TTS
S
SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence GSEWTEQKLDDPSSNTQNTEEGGSIPGLAGKNRSSSSSARIFSLFAEDNIELMPGTMLTPGLRWDHHDIV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TTTT


STTT
BBTTB
SS



TTTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GDNWSPSLNLSHALTERVTLKAGIARAYKAPNLYQLNPDYLLYSAGAGCYGQSTSCYLRGNDGLKAETSV
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) TT


TTTT
TT
SSTT
TT
SS


TT


 .........500.........510.........520.........530.........540.........550.........560
Sequence NKELGIEYSHDGLVAGLTYFRNDYKNKIESGLSPVDHASGGKGDYANAAIYQWENVPKAVVEGLEGTLTL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
SS
S
B

SGGG
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence PLADGLKWSNNLTYMLQSKNKETGDVLSVTPRYTLNSMLDWQATDDLSLQATVTWYGKQKPKKYDYHGDR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTT

BSS


S

SSS

B


SB
TTS
B
 .........640.........650.........660.........670.........680.........690.........700
Sequence VTGSANDQLSPYAIAGLGGTYRLSKNLSLGAGVDNLFDKRLFRAGNAQGVVGIDGAGAATYNEPGRTFYT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

GGGG

B

TTSTT


B




SS
BTTB


TT

S
B


 ......
Sequence SLTASF
Predicted secondary structure
SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D