Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mxzA_

Fold library idPDB HeaderMoleculeTitle
c5mxzA_1.90PDB header: electron transportChain: A: PDB Molecule: cytochrome c-552 ks_3358;


Added to library: Sat Feb 17 08:22:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IDGMKLFLQHCKTCHGVDGNPTDLGEGLGARKFADAEWQAKTSDERIIEQINEGTPEMMMPFKEKLTPEE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TTTTB
TTSSB
T


S




BTTTB


TTTS
 .........80..
Sequence VKALVPVVRGFK
Predicted secondary structure

SS confidence











Known secondary structure (DSSP) TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D