Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mwrB_

Fold library idPDB HeaderMoleculeTitle
c5mwrB_2.38PDB header: transcriptionChain: B: PDB Molecule: tetr family transcriptional regulator;


Added to library: Sat Feb 17 10:27:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLNKILDASVELIADKGFLSTSINDITSKAGVAYGLFYFYFKSKHDILDEIIRQFNRNXRYYLKTYTQNL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

STT

TS
GGG
SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DSRIDVEKVGXKKFLEWXNENKKYYKIFIETQVHRPDIYKWHFXKLAERYTTGLSEAXRRGEIINVDPEL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TSTT
TTSS

S
 .........150.........160.........170.........180...
Sequence LSYVLIGIAHXLGKRYVLWSNSGLTLKQQRDLDLIIENXLTPR
Predicted secondary structure












SS confidence










































Known secondary structure (DSSP) TS
SS


S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D